PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC013137.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 252aa    MW: 27991.5 Da    PI: 8.495
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC013137.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.23.9e-331972255
       G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                  prlrWtpeLH++Fv+a+++LGG++kAtPk +l+lm+v gLt++hvkSHLQ+YR+
  EcC013137.10 19 PRLRWTPELHQCFVHAIQRLGGQDKATPKLVLQLMDVRGLTISHVKSHLQMYRS 72
                  8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.6241575IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-321576IPR009057Homeodomain-like
SuperFamilySSF466893.76E-161774IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-241972IPR006447Myb domain, plants
PfamPF002492.7E-92071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGSCGRSGTV RQYVRSKVPR LRWTPELHQC FVHAIQRLGG QDKATPKLVL QLMDVRGLTI  60
SHVKSHLQMY RSMRSDLGRS DRGCGQQKRR AAEDDDPDRD GGCVEEVNDD EGPPHAFAKP  120
VHHSRFACSS PPCKRSRTEK VATTTTTTSA VAEQAPYGFE IAKLQDRMQM PRKGLKLRDW  180
RSFPLEEYEV SQGCELSLSL SLQCHSIHRS NGSSTSEISE AFSSCSRSRE CSGPYSDKSS  240
VNLDLSIALC GS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010043897.11e-162PREDICTED: uncharacterized protein LOC104432988
TrEMBLA0A059D6991e-162A0A059D699_EUCGR; Uncharacterized protein
STRINGVIT_01s0137g00050.t016e-75(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.12e-34G2-like family protein